PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo5G0065300
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family MYB
Protein Properties Length: 332aa    MW: 35997.6 Da    PI: 7.2917
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo5G0065300genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.53.6e-191461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++lvd+++ +G g+W++ ++  g++R++k+c++rw +yl
   Spipo5G0065300 14 KGPWTPEEDKKLVDYIQNHGHGSWRALPKNAGLNRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding54.42.8e-1767112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+++ eE+ l+++++  lG++ W++Ia++++ gRt++++k++w+++l
   Spipo5G0065300  67 RGKFSDEEERLIINLHSALGNK-WSAIAARLP-GRTDNEIKNYWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.0E-25564IPR009057Homeodomain-like
PROSITE profilePS5129417.493961IPR017930Myb domain
SuperFamilySSF466892.25E-3111108IPR009057Homeodomain-like
SMARTSM007175.2E-151363IPR001005SANT/Myb domain
PfamPF002491.2E-171461IPR001005SANT/Myb domain
CDDcd001673.98E-121661No hitNo description
PROSITE profilePS5129427.12662116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.4E-2765116IPR009057Homeodomain-like
SMARTSM007179.5E-1766114IPR001005SANT/Myb domain
PfamPF002493.6E-1667112IPR001005SANT/Myb domain
CDDcd001676.06E-1369112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 332 aa     Download sequence    Send to blast
MGRSPCCDEE GLKKGPWTPE EDKKLVDYIQ NHGHGSWRAL PKNAGLNRCG KSCRLRWTNY  60
LRPDIRRGKF SDEEERLIIN LHSALGNKWS AIAARLPGRT DNEIKNYWNT HLKKKLLHMG  120
IDPLTHRPRT DLSLLANLQG LLAASSLGNL PPGAWGLDNS FRIHADAAQA ARIQILQSLF  180
QALVPNNAPN VDLVHLLGAA MLNQPGRPFP GLLLGGEGQV NSAVPSLSAP QMMKEVPLPP  240
PSSSLPGSSS KNSVGVENNS SFSVSQMSSS GNNPTSTSTP SAVSPSPEGF NLDHFQEMIN  300
SHDGSSSCSL EPWDALTDTE SYDLCWRDIL A*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-31121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010933448.11e-113PREDICTED: transcription factor MYB39-like
TrEMBLA0A061EYD81e-107A0A061EYD8_THECC; Myb domain protein 107
STRINGVIT_16s0039g01710.t012e-97(Vitis vinifera)
STRINGGSMUA_Achr1P23990_0011e-97(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP112637132
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16770.24e-84myb domain protein 9